Your Cart
IGF-1-DES-1mg

IGF-1 DES 1mg

By Wicked Labz

$109.99

Out of stock

Categories: ,

Description

This product is being sold as a *Research Chemical* Bacteriostatic Water is required.
IGF-1 DES 1mg
Application A truncated version of IGF-1 in which the tripeptide Gly-Pro-Glu is absent from the N-terminus end of the protein.
CAS 112603-35-7
Molar Mass 7365.4225/mol
Chemical Formula C319H495N91O96S7
Amino Acid Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA
Synonyms Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1
Storage Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture.
Solubility Soluble in water
Organoleptic Profile Fine white powder  in 3mL glass aliquot
Composition Each aliquot contains IGF-1 DES 1mg
Specification IGF-1 DES content (per aliquot):
IGF-1 DES 1mg
Terms This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses.  Please click the word Research Chemical to better understand what they are.   *RESEARCH CHEMICAL.  You should also review our Terms & Conditions.

This product needs to be reconstituted with bacteriostatic water and is being sold as a research chemical only.

DISCLAIMER

By purchasing from Wicked Labz you agree that you are purchasing Research Chemicals.

Wicked Labz  products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.

*Research chemicals are chemical substances used by scientists for medical and scientific research purposes. One characteristic of a research chemical is that it is for laboratory research use only; a research chemical is not intended for human or veterinary use. This distinction is required on the labels of research chemicals, and is what exempts them from regulation under parts 100-740 in Title 21 of the Code of Federal Regulations (21CFR).

Research chemicals are not to be confused with Dietary Supplements and should not be used in such manner.

Quality Control

Lab tested with transparent Certificates of Analysis

Customer Support

100% dedicated to our customer's needs and wants

Payment Support

We are here to navigate you through our various payment options