IGF-1 DES 1mg
By Wicked Labz$109.99
Out of stock
Description
This product is being sold as a *Research Chemical* Bacteriostatic Water is required.
IGF-1 DES 1mg
Application | A truncated version of IGF-1 in which the tripeptide Gly-Pro-Glu is absent from the N-terminus end of the protein. |
CAS | 112603-35-7 |
Molar Mass | 7365.4225/mol |
Chemical Formula | C319H495N91O96S7 |
Amino Acid Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA |
Synonyms | Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1 |
Storage | Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture. |
Solubility | Soluble in water |
Organoleptic Profile | Fine white powder in 3mL glass aliquot |
Composition | Each aliquot contains IGF-1 DES 1mg |
Specification | IGF-1 DES content (per aliquot): IGF-1 DES 1mg |
Terms | This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please click the word Research Chemical to better understand what they are. *RESEARCH CHEMICAL. You should also review our Terms & Conditions. |
This product needs to be reconstituted with bacteriostatic water and is being sold as a research chemical only.
DISCLAIMER
By purchasing from Wicked Labz you agree that you are purchasing Research Chemicals.
Wicked Labz products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
*Research chemicals are chemical substances used by scientists for medical and scientific research purposes. One characteristic of a research chemical is that it is for laboratory research use only; a research chemical is not intended for human or veterinary use. This distinction is required on the labels of research chemicals, and is what exempts them from regulation under parts 100-740 in Title 21 of the Code of Federal Regulations (21CFR).
Research chemicals are not to be confused with Dietary Supplements and should not be used in such manner.
Quality Control
Lab tested with transparent Certificates of Analysis
Customer Support
100% dedicated to our customer's needs and wants
Payment Support
We are here to navigate you through our various payment options